PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G32650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 625aa    MW: 65442.3 Da    PI: 4.8969
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G32650.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS456.71.4e-1392416211374
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl...fsevsPil 91 
                      lv++Ll+cAeav+++++++a+al++++ +la+++g +m+++aayf eALa+r++         ++p +++     ++++a+ l   f+e +P+l
  ORUFI03G32650.1 241 LVHALLACAEAVQQENFAAAEALVKQIPTLAASQGGAMRKVAAYFGEALARRVYL--------FRPADST---LLDAAFADLLhahFYESCPYL 323
                      689***************************************************8........5555555...3333333333334******** PP

             GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakr 185
                      kf+h+taNqaIlea++g++rvH++Df+i+qG+QWpaLlqaLa Rp+gpps+R+Tgvg+p+++++++l+++g++La+fA++++v+f+++ lva +
  ORUFI03G32650.1 324 KFAHFTANQAILEAFAGCRRVHVVDFGIKQGMQWPALLQALALRPGGPPSFRLTGVGPPQPDETDALQQVGWKLAQFAHTIRVDFQYRGLVAAT 417
                      ********************************************************************************************** PP

             GRAS 186 ledleleeL......rvkp...gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                      l+dle+ +L      +       E++aVn+v++lhrll+++++le+    vL +v  ++P++v+vveqea+hns+sFl+rf+e+l+yys++fds
  ORUFI03G32650.1 418 LADLEPFMLqpegeaD--AneePEVIAVNSVFELHRLLAQPGALEK----VLGTVHAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDS 505
                      *********6555442..15579***********************....******************************************** PP

             GRAS 271 leak...........lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrve 352
                      le +           ++    +++++++++lgr+i+nvvacegaer+erhetl++Wr+rl++aGF+pv+l+++a+kqa++ll+ ++ +dgyrve
  ORUFI03G32650.1 506 LEGGssgqaelsppaAGGGGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGRAGFEPVHLGSNAYKQASTLLALFAgGDGYRVE 599
                      *88878888875554444449************************************************************************* PP

             GRAS 353 eesgslvlgWkdrpLvsvSaWr 374
                      e++g+l+lgW++rpL+++SaWr
  ORUFI03G32650.1 600 EKEGCLTLGWHTRPLIATSAWR 621
                      *********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120415.1E-3539113IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011291.7E-3139120No hitNo description
PROSITE profilePS5098566.457215600IPR005202Transcription factor GRAS
PfamPF035145.0E-137241621IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MKREYQETGG SSGGGSSADM GSCKDKVMAG AAGEEEDVDE LLAALGYKVR SSDMADVAQK  60
LEQLEMAMGM GGVSAPGAAD DGFVSHLATD TVHYNPSDLS SWVESMLSEL NAPLPPIPPA  120
PPAARHASTS STVTGGGGSG FFELPAAADS SSSTYALRPI SLPVVATADP SAADSARDTK  180
RMRTGGGSTS SSSSSSSSLG GGASRGSVVE AAPPATQGTA AANAPAVPVV VVDTQEAGIR  240
LVHALLACAE AVQQENFAAA EALVKQIPTL AASQGGAMRK VAAYFGEALA RRVYLFRPAD  300
STLLDAAFAD LLHAHFYESC PYLKFAHFTA NQAILEAFAG CRRVHVVDFG IKQGMQWPAL  360
LQALALRPGG PPSFRLTGVG PPQPDETDAL QQVGWKLAQF AHTIRVDFQY RGLVAATLAD  420
LEPFMLQPEG EADANEEPEV IAVNSVFELH RLLAQPGALE KVLGTVHAVR PRIVTVVEQE  480
ANHNSGSFLD RFTESLHYYS TMFDSLEGGS SGQAELSPPA AGGGGGTDQV MSEVYLGRQI  540
CNVVACEGAE RTERHETLGQ WRNRLGRAGF EPVHLGSNAY KQASTLLALF AGGDGYRVEE  600
KEGCLTLGWH TRPLIATSAW RVAAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-562416214375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0309560.0AB030956.1 Oryza sativa Japonica Group mRNA for OsGAI, complete cds.
GenBankAB2629800.0AB262980.1 Oryza sativa Japonica Group SLR1 gene for DELLA protein, complete cds.
GenBankAC0877970.0AC087797.5 Oryza sativa chromosome 3 BAC OSJNBb0022E02 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631543.10.0PREDICTED: DELLA protein SLR1
SwissprotQ2TN880.0SLR1_ORYSI; DELLA protein SLR1
TrEMBLA0A0E0P0890.0A0A0E0P089_ORYRU; Uncharacterized protein
STRINGORGLA03G0290200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein